PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_112_iso_10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 295aa    MW: 32347.3 Da    PI: 7.5418
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_112_iso_10genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-18552148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEde+l++++k+ G g+W++ ++  g+ R++k+c++rw +yl
  cra_locus_112_iso_10_len_1843_ver_3  5 KGPWTPEEDEKLIQYIKENGHGSWRSLPKSAGLLRCGKSCRLRWTNYL 52
                                         79******************************99************97 PP

2Myb_DNA-binding53.36.4e-1758103148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg++T+eE++l +++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  cra_locus_112_iso_10_len_1843_ver_3  58 RGPFTPEEEKLVIQLHAILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 103
                                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-31199IPR009057Homeodomain-like
PROSITE profilePS5129426.542156IPR017930Myb domain
SMARTSM007171.7E-14454IPR001005SANT/Myb domain
PfamPF002499.8E-17552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-24659IPR009057Homeodomain-like
CDDcd001679.82E-12752No hitNo description
PROSITE profilePS5129421.30557107IPR017930Myb domain
SMARTSM007177.3E-1657105IPR001005SANT/Myb domain
PfamPF002495.6E-1658103IPR001005SANT/Myb domain
CDDcd001674.65E-1260103No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2760108IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGLKKGPWTP EEDEKLIQYI KENGHGSWRS LPKSAGLLRC GKSCRLRWTN YLRPDIKRGP  60
FTPEEEKLVI QLHAILGNRW AAIASQLPGR TDNEIKNLWN THLKKRLICM GIDPQTHEPS  120
SSPSGLLKRL PASPSTRHMA QWESARLEAE ARLSRESSFS IPSSTGNFNS DYILRLWNSE  180
IGESFRNFNI KGNKIGRNNS SISLASSSTK CESVSVTAPE GGVLGLAGAS AAGSNQTEDP  240
DCRSSISPLA DVHHGSDSAG SDDLEDSSES TLQLLLDFPV AVWQILASIT QILGW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-3031075108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083427.11e-132PREDICTED: transcription repressor MYB6
TrEMBLA0A068UKS71e-146A0A068UKS7_COFCA; Uncharacterized protein
STRINGSolyc01g094360.2.11e-128(Solanum lycopersicum)